PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family SBP
Protein Properties Length: 371aa    MW: 42716.2 Da    PI: 6.7539
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490242.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.31.8e-42114190177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  XP_004490242.1 114 ICQVYGCNMDLSSSKDYHKRHKVCDVHSKTAKVIVNGVEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 190
                     5**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-34110176IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.83112189IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.16E-40113195IPR004333Transcription factor, SBP-box
PfamPF031104.3E-32115188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MESWSYIPEE RSYLFSDEMD FSLDAFMMRS RKPFIEFENK SSCNFERDST FGEEDSDSKH  60
LSSLDESKTH DSSLIDLKLG RLDRDVKAFT STPIHQTALS KKARTSRLPA HAPICQVYGC  120
NMDLSSSKDY HKRHKVCDVH SKTAKVIVNG VEQRFCQQCS RFHLLAEFDD GKRSCRRRLA  180
GHNERRRKPQ FDYMTNKQHK ILQSYQGTKY LESSIQNIPH FDFQDIFQSG HIKLEEEPNF  240
SPQLASPATL GHELSSRALS LLSSPSQNPS RHAAENPLTN SLIYRGIRTQ DNNDQVSETP  300
LNISSVDKHN QNESFPFSDD ICETSESMNI KSEHGVTVDL FQLSSHLQRV EQQRNSVLVK  360
WXNEDYCFPT V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-301141881084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004490242.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9329681e-58CR932968.2 Medicago truncatula chromosome 5 clone mth2-8e17, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490242.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 6
TrEMBLA0A1S2XLV40.0A0A1S2XLV4_CICAR; LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 6
STRINGXP_004490242.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-64SBP family protein