PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Whirly
Protein Properties Length: 255aa    MW: 28516.7 Da    PI: 8.9041
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490008.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly193.33.5e-60832201138
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     svyk+ka l+v +++p+f++++sg++k++r+G +ll++a+a+++ +ydW++kq+f+ls+ e+++l++l++k+sce fhdp+ ++++eGkvrk+lk
  XP_004490008.1  83 SVYKGKAVLTVSPRAPEFTSMESGSFKISREGCMLLQFAPAVGVHQYDWNRKQVFSLSVNEMGSLISLGAKDSCEIFHDPFIGKGDEGKVRKVLK 177
                     79********************************************************************************************* PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                     vePl dGsG+++nlsv+n++ + nes+ +Pv+kae av++sl+
  XP_004490008.1 178 VEPLQDGSGHMFNLSVQNKIENINESIFIPVTKAELAVFNSLF 220
                     ***************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.6E-7172240IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544474.16E-6776254IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.4E-5884218IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MLQTQSYTIT TKPFSVSNHS FTTPIKSIPL RHAGPTFSIS LPQFSVTCHH PQLFQQKPFP  60
PPPQRPQPPS VGELTPRVFV GHSVYKGKAV LTVSPRAPEF TSMESGSFKI SREGCMLLQF  120
APAVGVHQYD WNRKQVFSLS VNEMGSLISL GAKDSCEIFH DPFIGKGDEG KVRKVLKVEP  180
LQDGSGHMFN LSVQNKIENI NESIFIPVTK AELAVFNSLF HFIMPCLLGW NAFGSSIKPE  240
VYTANPKHED YEWNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D5e-867225432219p24: plant transcriptional regulator PBF-2
1l3a_C5e-867225432219p24: plant transcriptional regulator PBF-2
1l3a_B5e-867225432219p24: plant transcriptional regulator PBF-2
1l3a_A5e-867225432219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490008.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X1
SwissprotQ9M9S36e-93WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLG7KB191e-113G7KB19_MEDTR; Single-stranded DNA-binding protein WHY3
STRINGGLYMA08G40850.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.24e-93ssDNA-binding transcriptional regulator