PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004489381.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 296aa    MW: 34213 Da    PI: 7.1919
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004489381.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.7e-19101153456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  XP_004489381.1 101 KKRLSLEQVKALEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 153
                     556899**********************************************9 PP

2HD-ZIP_I/II127.46.2e-4199191193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprqva+WFqnrRAR+ktk+lEk+ye Lk++++alk++n+ L++++++L++el++
  XP_004489381.1  99 EKKKRLSLEQVKALEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKHLEKEYEILKKQFEALKADNDILKAQNNKLHAELQT 191
                     69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-1994156IPR009057Homeodomain-like
PROSITE profilePS5007117.295155IPR001356Homeobox domain
SMARTSM003891.0E-1898159IPR001356Homeobox domain
CDDcd000862.87E-16100156No hitNo description
PfamPF000463.0E-16101153IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-20107154IPR009057Homeodomain-like
PRINTSPR000318.4E-6126135IPR000047Helix-turn-helix motif
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PRINTSPR000318.4E-6135151IPR000047Helix-turn-helix motif
PfamPF021833.7E-13155194IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAFPPSHTFI FQTHEDHHHH HDHLLSSSTT SLNSFPSFPT HHHFQGGSGA PFMMKRSMSF  60
SGIENNHNQN YNNNNKCEEL VHGDEDQLSD EEGYSQIGEK KKRLSLEQVK ALEKSFEIGN  120
KLEPERKMQL AKALGLQPRQ VAIWFQNRRA RWKTKHLEKE YEILKKQFEA LKADNDILKA  180
QNNKLHAELQ TLKKRDCFEN GTISFKKENE GSWSNGSDNS SDINLGLSRT PMMNSPVSSQ  240
NGKSILPNSL KPTSMTQLLQ CSSRSDLQDE SFCNMFHNID DQQNFWPWPD QQHHFH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004489381.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1484820.0BT148482.1 Medicago truncatula clone JCVI-FLMt-17G6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489381.10.0homeobox-leucine zipper protein HAT7-like isoform X1
SwissprotQ004663e-77HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A1S2XHC60.0A0A1S2XHC6_CICAR; homeobox-leucine zipper protein HAT7-like isoform X1
STRINGXP_004489381.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.16e-68homeobox 3