PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004488297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 299aa    MW: 34430.9 Da    PI: 4.6676
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004488297.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.63.4e-13952144
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    kri+n+  r++tf  R+ng+ KK +E S   +aev++i++ s+g
  XP_004488297.1  9 KRIQNEKARKTTFVHRKNGLSKKVSEFSSIFGAEVCLIVYDSDG 52
                    79**************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-13160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-17177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.507161IPR002100Transcription factor, MADS-box
CDDcd002664.99E-17276No hitNo description
PRINTSPR004041.4E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.4E-141052IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRPKTNLKR IQNEKARKTT FVHRKNGLSK KVSEFSSIFG AEVCLIVYDS DGSDIPMTFP  60
ENATTVQSML KKYEHQKIET TLEEFGVKDY YANKKNLVEA QISRVRKEIL KKKYPTSSPI  120
FNNMEEEQLK AFIAFVDSKI EACNHMLKNM QQKDTCFVQN MAQDSDVCLH SSQDNVVMHS  180
LPHMQHITDC MEPTNDEISE WIDFSDLSDL PPVPSTNQLS KLVDWDDMKI ESEEFTSFIQ  240
NTMQNITYDN ILSSHSSQLD VNHNIPQMQN INGCMLSLYD DICDTVDFTD LIDWDNIVV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004488297.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004488297.10.0MADS-box protein FLOWERING LOCUS C-like
TrEMBLA0A1S2XEX60.0A0A1S2XEX6_CICAR; MADS-box protein FLOWERING LOCUS C-like
STRINGXP_004488297.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.19e-16AGAMOUS-like 82