PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004485856.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family WOX
Protein Properties Length: 409aa    MW: 45444.7 Da    PI: 7.9294
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004485856.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.4e-1855115257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  XP_004485856.1  55 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 115
                     89*****************99*************************************995 PP

2Wus_type_Homeobox112.13e-3654116264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
     XP_004485856.1  54 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 116
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-741114IPR009057Homeodomain-like
SuperFamilySSF466896.42E-1251119IPR009057Homeodomain-like
PROSITE profilePS5007110.51151116IPR001356Homeobox domain
SMARTSM003896.8E-953120IPR001356Homeobox domain
CDDcd000864.62E-854116No hitNo description
PfamPF000462.2E-1555115IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPACNP HHQWQHDINS SLISSSCHRT PYSSEGCEER SPEPKPRWNP  60
KPEQIRILEA IFNSGMVNPP RDEIRKIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKLRHL  120
QNQNSSKNQQ NILNQEPPTQ QQNPNPISSS LPQITPPSSS SSSSEKSPPK EIIPSKVFSL  180
GFSNINDVVP NSPTTSVNQT YLHSQNETTL LPPPPQQQQV ASATNETNFF FPMQQHGQGI  240
VLPNNVVTSQ GFCFSELSNM VHAQPHNTGH CTSFLLSEIM NHGANSSKKD QDQDNKSVKI  300
MHQIPHFNFC FTPTTSTTTV VPPTTSSTIT VPSPIISHAQ GHGETGVTAA RSMVFINDVA  360
FEVASGPFNV REAFGDEAVL IHATGQPVLT NQWGVTLQSL HHGACYYLI
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004485856.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004485856.10.0WUSCHEL-related homeobox 9-like isoform X1
TrEMBLA0A1S2X9U60.0A0A1S2X9U6_CICAR; WUSCHEL-related homeobox 9-like isoform X1
STRINGXP_004485856.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-65homeobox-3