PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004485835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1785aa    MW: 201345 Da    PI: 5.4345
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004485835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.3e-1848103257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      kR+  t+ qle+Le++++ ++yps+ +r eL++klgL++rq ++WF+ rR k+kk
  XP_004485835.1  48 PKRQMKTPFQLETLEKAYALENYPSEVTRVELSEKLGLSDRQLQMWFCHRRLKDKK 103
                     69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-1826104IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1733103IPR009057Homeodomain-like
PROSITE profilePS5007116.69844104IPR001356Homeobox domain
SMARTSM003898.8E-1846108IPR001356Homeobox domain
PfamPF000469.1E-1648103IPR001356Homeobox domain
CDDcd000861.08E-1349104No hitNo description
SMARTSM005717.2E-21577636IPR018501DDT domain
PROSITE profilePS5082716.732577636IPR018501DDT domain
PfamPF027912.0E-16579633IPR018501DDT domain
PfamPF050662.4E-14758825IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156127.4E-99681010IPR028942WHIM1 domain
PfamPF156134.8E-1311491221IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1785 aa     Download sequence    Send to blast
MDVEAENNTQ KGDDGGENSN ENNNNNNNMN NNGSNSKIMS SSEGQSKPKR QMKTPFQLET  60
LEKAYALENY PSEVTRVELS EKLGLSDRQL QMWFCHRRLK DKKELPPKKP RKAPPLPDSP  120
TDELNPKLAI EPVNEYGSGS GSGSSPIARP ELRSVVPTRT YYESPQTIIE LRAIACVEAQ  180
LGEPLREDGP ILGTEFDPLP PDAFGAPLAV AEQQKRPSLP YDSKIYERHE VRTNKAVART  240
FPEYTFVPSQ SSIRSDTFGQ LSQPHLYDSM EGPTRTPPFP IGNEHLPRVH ASQNHSSRAR  300
LLSQQDKPVI PYTSPPHLLS QQDKQLIPYP SPPRDNDVVP KREPHTNIAN TSMNTQFSDH  360
LIVGQENSLA LGLPGGQVLH NDAVLRVEKK RKSDDARVAK EVEAYEIRMK KELEKQDILR  420
KKNEERMKKE MERQDRERRK EEERLMRERQ REEERLKREH RRELERREKY LIKEHLRAEK  480
RKQKEEIRKE REAERRKAAL EKANARRIAK ESMELIEDEQ LELMELAAAS KGLSSIIHID  540
LDTLQNLESF RDSLCIFPPK SVKLRKPFAI QPWINSEQNV GNLLMVWRFL ITFADVLELW  600
PFTLDEFVQA FHDYDTRLLG EIHVALLKVV IKDIEDVART PSGLGLNQNG AANPAGGHPE  660
IVEGAYTWGF DIRNWQKNLN QLTWPEILRQ LALSAGFGPQ LKKRSVTWSI ANDKDEGRSC  720
EDVISTLRNG SXAVSAVAKM REKGLLAPRK SRHRLTPGTV KFAAFHVLSL EGSKGLNVLD  780
LAEKIQKSGL RDLTTSKTPE ASISVALTRD AKLFERIAPS TYRVRTAFRK DPADAVSILS  840
EARKKIQIFE NGFLAGEDAD DVEREEESES DGVDEDPEDD DLMNPSGGNQ VSEQYDDMNI  900
CSVNVKENLG HDVDLILNEL DTDLPCFPEN GSKDADCPSS VTRQPAACEN LNTGNLDDDN  960
MEIDETKSGE SWVQGLTEGE YSDLSVEERL NALVALVGVA NEGNSIRIVL EDRLEAANAL  1020
KKQMWAEAQI DKVRLKDDYI SKLDFPSLTG NKFETQDTYL AVEGNQSPML NMNINNIKNE  1080
ASPSTAENQK EAPGAQNLLI ERPSAVQDFC TGTGPDNFQA QVPAQYSKRS RSQLKSYISH  1140
IAEEMYVYRS LPLGQDRRRN RYWQFVASAS SNDPGSGRIF VEHHDGSWML IDSEEAFDIL  1200
LTSLDSRGIR ESHLRLMLQK IEKSFKENVR KNTQYAKVGS IGEVSIKTEA KETYPKPEHH  1260
SRSDSPSSTL HDLHPDASET SSSFKIEIGK SENEKKAALK RYQDFQKWMW KECYSSSILC  1320
AMKFGIKRCK PQVDMCEFCL NPYSVEDSHC SSCHQTFPSN NGFNFSKHAF QCGGKLSKDI  1380
CIMEHSLPLR TRLLKVLLSY MEASVLSEAF GTIWTTDFRK RWGVKLSKSS SVEELLQMLT  1440
LFERALRRDF LSSNFSTTDE LLGSSSLSES AAHVFPDPES IALLPWVPQT TAALSLRLFE  1500
FDSSISYVKL ERIEPCEEKE EREYIRLPSR YTPFKSNREV EPAALDHDGF LKVKSSANKI  1560
VRSGNKRGRG ASDHGRGKKL AKRMYNSKRD TGRRNVKVTE SLSQKLKQQG RGTQGQGGGR  1620
GRRTVRKRRV EKRAVEDLLL GHAAASHSPK SDREPLRSLD EEWDVEKASP MTPVHIGVAE  1680
NSNSAEEVES DDNGQAVEYD HGNWEIGYNG VSPNNWNRDL VGMSDDDVDT FEDDNDNDND  1740
NNIGVGIEDN EEEDSDDDVM SEGSDGMANR IVNVGGGSDS EDSSD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRLKDKKE
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004485835.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1584970.0AC158497.2 Medicago truncatula chromosome 2 clone mth2-48e18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004485835.10.0homeobox-DDT domain protein RLT1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A1S2XCH60.0A0A1S2XCH6_CICAR; homeobox-DDT domain protein RLT1
STRINGXP_004485835.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator