PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g22480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 159aa    MW: 17607.4 Da    PI: 7.8407
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g22480genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601413.7e-44141131100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C++dCv++pyfp+++p+kfa vhk+FGasnv k+l++lpe +r da+ss+vyeA+ar++dP+yG+vg+i++lq+q+e l+++la +++
  CA12g22480  14 PCAACKLLRRRCTQDCVFSPYFPSDEPHKFASVHKVFGASNVNKMLQELPEYQRGDAVSSMVYEANARMKDPIYGCVGTISSLQHQIEFLQKQLAIAQA 112
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  CA12g22480 113 E 113
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.86113114IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-4414111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MKESGGRKQG ATSPCAACKL LRRRCTQDCV FSPYFPSDEP HKFASVHKVF GASNVNKMLQ  60
ELPEYQRGDA VSSMVYEANA RMKDPIYGCV GTISSLQHQI EFLQKQLAIA QAEIVHMKMQ  120
QPSSMYRGGG GTXXXXXXXP PIHMQSEAHS EFEACDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-48101157112LOB family transfactor Ramosa2.1
5ly0_B3e-48101157112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754519e-82HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552419.11e-108PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE95e-62LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2G2YBE61e-108A0A2G2YBE6_CAPAN; LOB domain-containing protein 4
STRINGSolyc12g100150.1.15e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-64LOB domain-containing protein 4