PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g20310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 294aa    MW: 32432.7 Da    PI: 6.6745
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g20310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.92.7e-3451105155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  CA12g20310  51 RPRLRWTAELHERFVDAVTQLGGPDKATPKTIMKAMGVKGLTLYHLKSHLQKYRL 105
                 59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-3248106IPR009057Homeodomain-like
PROSITE profilePS5129413.0348108IPR017930Myb domain
SuperFamilySSF466892.87E-1750107IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-2452106IPR006447Myb domain, plants
PfamPF002492.3E-953104IPR001005SANT/Myb domain
PfamPF143791.6E-25149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MKMYSGLGME RNGGMGEYHN HHFHHNLQSS ITGEMNNLVG DACLVLTADH RPRLRWTAEL  60
HERFVDAVTQ LGGPDKATPK TIMKAMGVKG LTLYHLKSHL QKYRLGKQSK EAAENYKDES  120
CMAESQDTSS TASGSSKVVA QDINDCGYQV TEAFRVQMEV QRRLQEQLEV QRHVQLRIEA  180
QGKYLQTILE KACKALNYTA LESPELDTAR EQLSELAIKG ANANNCDGIV AVSSLPEVVT  240
SFENQNASDM PATSLVSPTS IGVLKKRPRP LANGDALPVE DNMTPVQWMM TNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1951107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1951107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1951107157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1951107157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1951107258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265269KRPRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754513e-89HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551770.10.0PREDICTED: myb family transcription factor APL isoform X1
SwissprotQ8LAJ71e-101PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A1U8F7R60.0A0A1U8F7R6_CAPAN; Myb family transcription factor APL
TrEMBLA0A2G2YAW10.0A0A2G2YAW1_CAPAN; myb family transcription factor APL isoform X1
STRINGPGSC0003DMT4000115981e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.16e-83G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]