PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g19270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family CO-like
Protein Properties Length: 370aa    MW: 41108.1 Da    PI: 6.2579
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g19270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.22.8e-071143436
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                + C+ ++   ++ fC+ ++ +lC  C +++H  
  CA12g19270 11 KLCDSCKTTSATVFCRADSAFLCLLCDSKIHAA 43
                68******99*********************54 PP

2zf-B_box28.23.9e-095398342
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                 ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  CA12g19270 53 VWVCEVCEQAPASVTCKADAAALCVTCDNDIHSAnplarrHERVPV 98
                689*****************************66899999*99986 PP

3CCT70.54.3e-24305348144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  CA12g19270 305 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 348
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.9E-11855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.281855IPR000315B-box-type zinc finger
PfamPF006439.9E-61150IPR000315B-box-type zinc finger
CDDcd000215.84E-81255No hitNo description
PROSITE profilePS5011910.7935198IPR000315B-box-type zinc finger
PfamPF006432.2E-75398IPR000315B-box-type zinc finger
CDDcd000211.14E-85498No hitNo description
SMARTSM003361.9E-105698IPR000315B-box-type zinc finger
PfamPF062032.5E-18305347IPR010402CCT domain
PROSITE profilePS5101716.896305347IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGLDTWSLTA KLCDSCKTTS ATVFCRADSA FLCLLCDSKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD NDIHSANPLA RRHERVPVVP FYDSNVEVKS HGGTDGDDDE  120
VIMMKIYTHV HRNQHMMYKI NSCPLEEAEA ASWILQNPKE VTDDQHQYKS SCVGDFSFND  180
MDSYLDMDIM SIEQKPQIHH HHPEHQHHGN YSSTDGVVPE ATTYLPGPVV DGFPSYEMDF  240
AGSKPYLYNF NSQSISQSVS SSSMDVGVVP DHSIMTDESN TFMITSSALG AVGDTAPNPL  300
SGVDREARVM RYREKRKNRK FEKTIRYASR KAYAETRPRI KGRFAKRTEI EIDSLIAVDA  360
SSYGVVPSF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551930.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X1
SwissprotQ940T92e-97COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2G2YAN60.0A0A2G2YAN6_CAPAN; Zinc finger protein CONSTANS-LIKE 4
STRINGSolyc12g096500.1.11e-175(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.16e-95CONSTANS-like 4