PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g13050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family bZIP
Protein Properties Length: 373aa    MW: 42379.6 Da    PI: 7.9735
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g13050genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.8e-1088128343
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                 ++k +rr+++NReAAr+sR RKka++++Le+   +L +  +
  CA12g13050  88 SDKIQRRLAQNREAARKSRMRKKAYVQQLEKSNLKLAQLEM 128
                 5899**************************86655555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-486149IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.05988132IPR004827Basic-leucine zipper domain
PfamPF001704.1E-789128IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.56E-790126No hitNo description
Gene3DG3DSA:1.20.5.1705.7E-891133No hitNo description
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
PfamPF141447.4E-29177249IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MQVFLFIQSM NMSSPSTQFA PTRRMGIFEP FHHMSVWEDT FRGDIMPSTA ACMVTPTNDR  60
ADDKSGYTSS EQLIPSGSED NQAGKSISDK IQRRLAQNRE AARKSRMRKK AYVQQLEKSN  120
LKLAQLEMEL ERARQQGLYI LGSNGNMGLS STINPGIAAF EMEYSLWVEE QQKKNVELRN  180
ILQSHVTEME LQLLVETVLN HYYNLFRMKA DAAKADVFYL MSGMWRSSVE RFFLWIGGFK  240
PSELINIVMP QLEPLSDQQI VKICNLRHCC QQAEDALTQG MDKLQQTLAQ GILTMTTGMG  300
SYSSQMVSSM EKLEALESFV NQADHLRQQT LQQMSLILTT RQSARGLLAF GEYLQRLRAL  360
SSLWAARPRE PT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551954.10.0PREDICTED: transcription factor TGA7-like
RefseqXP_016551955.10.0PREDICTED: transcription factor TGA7-like
RefseqXP_016551957.10.0PREDICTED: transcription factor TGA7-like
RefseqXP_016551958.10.0PREDICTED: transcription factor TGA7-like
SwissprotQ93ZE21e-153TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A1U8F8B90.0A0A1U8F8B9_CAPAN; Transcription factor TGA7
TrEMBLA0A2G2Y8K50.0A0A2G2Y8K5_CAPAN; transcription factor TGA7-like
STRINGPGSC0003DMT4000436510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-156bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]