PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g04150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 146aa    MW: 16192.8 Da    PI: 9.1744
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g04150genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.53.6e-46121111100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++C++apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k+
  CA12g04150  12 PCAACKFLRRKCQPECTFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLSCAKS 110
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  CA12g04150 111 E 111
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.99311112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4512109IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MSSSSSLSSN SPCAACKFLR RKCQPECTFA PYFPPDQPQK FANVHKVFGA SNVTKLLNEL  60
QPHQREDAVN SLAYEADMRL RDPVYGCVGV ISLLQHQLRQ LQMDLSCAKS ELSKYQNLGG  120
MCVQSLSTLR LSLCGIVRIL RVKRV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-126HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552464.11e-85PREDICTED: LOB domain-containing protein 6
RefseqXP_016552465.11e-85PREDICTED: LOB domain-containing protein 6
SwissprotO044796e-68LBD6_ARATH; LOB domain-containing protein 6
TrEMBLK4D5E34e-85K4D5E3_SOLLC; Uncharacterized protein
STRINGSolyc11g008830.1.11e-84(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-66LBD family protein