PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g01450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 359aa    MW: 40343.9 Da    PI: 8.6651
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g01450genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32269322255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  CA12g01450 269 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 322
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15266322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28267322IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24269322IPR006447Myb domain, plants
PfamPF002496.0E-7270321IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MPLEGAFIET PSSTKPIPDL SLNISPPNSL DHHHNHQSGX RCCVSEVGEN HERLVTEFSK  60
TTGSSNCLTE LSLAHPTNTT TTTITTTVTN AITNDDMTTT TRRGTFLDHL PRNPYYNNHQ  120
HQYQNYSHMV QPMNQINHGV SSLDVSDGLC PIKGIPVYNH NRSFPFLAST LDKEKDPKMC  180
FYPSPSSSSS SSCSPSPYFN SRFNGISSSA YHMPHHHHHH HPLPYHHHSQ YGHVGGLGHS  240
HHDNIANSHS LMRSRFLPKL PTKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL  300
ELMDVKDLTL AHVKSHLQMY RTVKTTDKPA VSSGKLSCFN SFTFLPFFTF VDNNIQFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16270324458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-144HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552242.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A2G2Y5700.0A0A2G2Y570_CAPAN; Putative transcription factor KAN2
STRINGPGSC0003DMT4000346631e-160(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-53G2-like family protein