PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g18280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 157aa    MW: 18424.9 Da    PI: 8.6856
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g18280genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR181.91.1e-2561147190
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 kfY +Y ++ GFsvrk++ ++s++++++++r+fvC ke ++++++ k   + ++r etr gCka++ ++k++++kw++++l+l+HnHela
  CA11g18280  61 KFYLDYTHHNGFSVRKNRITRSRKHKSMIDREFVCAKEEFHSKKSLK---SDKKRDETREGCKAMMYLSKKEEEKWVIARLVLNHNHELA 147
                 6****************************************999877...89999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-2361147IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MQDTLESFNL KEQNAKGTEG SLEEIESTVN EIVSFVLQSG DEESREPYIG MKFQSLDVRF  60
KFYLDYTHHN GFSVRKNRIT RSRKHKSMID REFVCAKEEF HSKKSLKSDK KRDETREGCK  120
AMMYLSKKEE EKWVIARLVL NHNHELASPQ SQIFLR*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019068484.12e-75protein FAR1-RELATED SEQUENCE 5
RefseqXP_025884722.12e-75protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G2YHN91e-108A0A2G2YHN9_CAPAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA645860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.27e-20FAR1 family protein