PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g12620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 464aa    MW: 50317.1 Da    PI: 9.1067
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g12620genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.22.4e-38174251178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +CqvegC+  ls+akey+r+h+vC+ hsk+p+v+v+g+ +rfCqqCsrfh++sefDe+krsCrrrL++hn+rrrk+q+
  CA11g12620 174 CCQVEGCNLVLSSAKEYYRKHRVCDSHSKCPKVIVAGVARRFCQQCSRFHSVSEFDEKKRSCRRRLSDHNARRRKPQQ 251
                 6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-31167236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.915172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-36173254IPR004333Transcription factor, SBP-box
PfamPF031104.7E-30175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEWNVKWDWG NLVMFGSKAS ESPKELQLTD WGVEEEGELD GGSFNLSSGG SGGYGSDVKC  60
GSSVKSSISA STDSSPKEGF KAPNFAFEVF DVSNEDRSKK LEPSKVEVFR KSPPMETSVG  120
SVEPVIGLKL GKRICETIGG GSSAKVSSSF PNPTSSAAAT KKAKSSSQNA PIPCCQVEGC  180
NLVLSSAKEY YRKHRVCDSH SKCPKVIVAG VARRFCQQCS RFHSVSEFDE KKRSCRRRLS  240
DHNARRRKPQ QETIQFNSAR LSSLFYGNSQ PMNFILNHAQ LIHSRAAANS TWERTQDSKF  300
SITRGFTPKA ERTGSTNGKS LLEGIQFSGG VGAQSNASSL FLPSKGTTAE VSHQGAKEST  360
FNMVIGPEFP RALSLLSTNS WGSSEPETVS LRHANQTSMP EQMMQAIPQG VPHISSQYWQ  420
GGQHSSGPRD HTLAANSHSG GSLQEMGLFK APFDTYFYLN AFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-24166248284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230247KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016538564.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A2G2YFA30.0A0A2G2YFA3_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000847340.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-52squamosa promoter binding protein-like 2