PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g03310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 549aa    MW: 60193.5 Da    PI: 7.555
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g03310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.8e-42233309177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv+gC++dls+ k+yh+rhkvC+ hsk++ v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  CA11g03310 233 VCQVHGCNKDLSSSKDYHKRHKVCDEHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQ 309
                 6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-33228295IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.624231308IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-39232313IPR004333Transcription factor, SBP-box
PfamPF031104.4E-32234307IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MEPLSYALEG GGLVFPDNVE LPAYTTSRSR NIVKEWNLNP FCDVDKSICG FSEEITESTE  60
LLGSGIADIL KKSAASNPCP GFLSGEMGDG CGKMLSSGSM FTFEPIPGEA GLGAMFNHSG  120
TKSNNPMSSS LMDLKLEELT DHGELRTSQS SKESSVLSSP DSSLPTGKAQ TKSLRSQFSI  180
SQVHGQKEEE SATVYRDGKN NQSLKRNSSL SSVNPALQGK KLRATNFHSE VPVCQVHGCN  240
KDLSSSKDYH KRHKVCDEHS KTAIVIVNGI EQRFCQQCSR FHLLAEFDEG KRSCRKRLAG  300
HNERRRKPQF DTHWGSRFLD MTSQRRVPFL FPEIFPGSFF YQENYEDNNN SKHVKLELKP  360
FCISELAVSV KNGQFPAKSI QHQYGMRKQD PSKVHVGATF SVPEISVGQN SSCAPSLLST  420
GISSTLPWMV QGNHNAYIKG DHLNLVKSAR VGVTSSSTPI ELYSSEVVEQ DGVVVQVPGS  480
EAVSFGIQRD HGHGQRSSAI ISKNCLSPEG GPTMDLVQLS SHLQRVEQQK NSVQVKQEND  540
IFCAFTST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-29229307684squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732940.0LC073294.1 Nicotiana tabacum NtabSPL6-6 mRNA for squamosa promoter binding protein NtabSPL6-6, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548264.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2G2YD210.0A0A2G2YD21_CAPAN; Uncharacterized protein
STRINGSolyc05g012040.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-53SBP family protein