PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g20900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 447aa    MW: 50648.7 Da    PI: 6.9783
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g20900genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-32264318155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  CA10g20900 264 KTRIRWTQDLHDRFVECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRN 318
                 68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.614261321IPR017930Myb domain
SuperFamilySSF466891.22E-16262318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28262319IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-24264319IPR006447Myb domain, plants
PfamPF002493.5E-8268317IPR001005SANT/Myb domain
PfamPF143797.4E-20348395IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSIQNYELPS DYNLEFPQMG FCFQPENDHQ QQQQQQNLWP SNDSSSSSRS MISRIGSSPS  60
GFFATERYLG LTQYEYQDNN NNNSCSQLSK NHDPQVAAFT QQCGNGFLVT SSSARVDTDI  120
PRISMPSFIR PLDSHGLYGN PFSNLSEKER VLLLKSKLFR EIDSSNRQPA ASMTFQGNQD  180
YGVKGHGFKP WKQPLAEMQG KAAYDTPLWW GPSPDTAHSG SVSAPGCPFM KVCCKENLAV  240
IVNCCYREVK TPLYVPTGGS LSSKTRIRWT QDLHDRFVEC VNRLGGADKA TPKAILKLMD  300
SEGLTIFHVK SHLQKYRNAK FIPESTEGKT EKMDKQNNVT QIDGKTGMQI KEALHMQLEV  360
QRRLHDQLEI QRKLQLRIEE QGEQLKKIFE QQQQTTRSLL ETRNSSISSH ADPFSPHEDE  420
VFVAESFDNS HFQSKISYND METTFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-22264321158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-22264321158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-22264321158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-22264321158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-22264321259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543872.10.0PREDICTED: uncharacterized protein LOC107843940 isoform X1
TrEMBLA0A2G3BHT90.0A0A2G3BHT9_CAPCH; Putative Myb family transcription factor
STRINGPGSC0003DMT4000297580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.19e-70G2-like family protein