PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g19330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 377aa    MW: 42837.7 Da    PI: 5.2843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g19330genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.91.1e-28214268155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rWt++LH+rF+e+ ++LGG++kAtPk+il+lm+ ++Ltl++vkSHLQkYR 
  CA10g19330 214 KTRIRWTEDLHDRFLECANRLGGADKATPKQILNLMDSESLTLDQVKSHLQKYRN 268
                 68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.255211271IPR017930Myb domain
SuperFamilySSF466892.33E-16212268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-26213269IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24214269IPR006447Myb domain, plants
PfamPF002492.3E-6218267IPR001005SANT/Myb domain
PfamPF143795.2E-19313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MSIQRFISTQ GNEFSSDCTL EFPKSSGQVQ DFVDQQLQYS SYMELCNFQL ASSSSSSIIS  60
CIGSPSSAFF ATERCLGLTQ YDNQDDTSQT ENYDLQMSSY DPQQCRNGFF EDSMVQSEPI  120
SLPSFISPEG PCRQYTFSDA SEEERMLHLK NKLLGEFDAS YRRHPALPFD GNQDYCLSHD  180
LCGSQLTRMR QQSLSPSLTC HNSASSGATQ KPSKTRIRWT EDLHDRFLEC ANRLGGADKA  240
TPKQILNLMD SESLTLDQVK SHLQKYRNAK HPESAGKSEK RNSLDTVTDI ESKTYATCYS  300
LRFNLLILLF MLVQITEALK MQLEVQRCLH EQLENQRTLQ TRIEEQAKKL RMILDQQQNT  360
NRTVLETRNS NVSSDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-17214271158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17214271158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17214271158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17214271158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-17214271259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544890.10.0PREDICTED: uncharacterized protein LOC107845150
TrEMBLA0A2G2YNP30.0A0A2G2YNP3_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000608551e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-47G2-like family protein