PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g17970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 365aa    MW: 42749.9 Da    PI: 6.4257
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g17970genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-32220275156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  CA10g17970 220 KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 275
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.792217277IPR017930Myb domain
SuperFamilySSF466898.33E-19218278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29218278IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-28220275IPR006447Myb domain, plants
PfamPF002497.0E-8222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMINNNNFNE KMQRCQQYID ALEEERRKIQ VFSRELPLCL ELVTQAIETY KQQLSGTTTE  60
YNLNAQSDEC SDDDEHTSSD VPILEEFIPL KRTFSHEYED QEDAHDEENE SHKSKNNNSN  120
NSTISKDNKS NTKSDWLRSV QLWNQTSDPT LKEVIDFYYF LTFNLFLFFL FFFIFKISRN  180
IFFCDYSILG IYLSLYVIIQ LSLALVRLKE NKKEKDGQRK QRRCWSPELH RRFLQALQQL  240
GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS PSSIHNNNNQ QPPQFVVVGG  300
IWVPPPDYAS MAAVAXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  360
PQSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-14220273255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-98HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548806.11e-166PREDICTED: transcription factor LUX
TrEMBLA0A2G3B6F80.0A0A2G3B6F8_CAPCH; Protein PHR1-LIKE 1
STRINGSolyc05g009720.2.11e-137(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-69G2-like family protein