PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g16780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 416aa    MW: 46407.7 Da    PI: 6.6566
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g16780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.5e-334498155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  CA10g16780 44 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3841101IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-3142100IPR009057Homeodomain-like
SuperFamilySSF466896.27E-1743101IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-244499IPR006447Myb domain, plants
PfamPF002492.5E-104697IPR001005SANT/Myb domain
PfamPF143798.6E-25143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MYHHHHQATN MHSSTRMSFP ERHLFLQGGN ANGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VNQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NHHGQANSSG DNKAAASMEK  120
ICESTGSPTS NPSIASQPNN NIPISEAIQM QIEVQRRLHE QLEVQRHLQL RIEAQGKYLQ  180
AVLEKAQETL GTQNLGTIGL EAAKVQLSDL VSKVSNQCLN SAFSEIQELS GFHTPQTQAT  240
QRLADCSLDS CLTSSEGPLR DLQEMHNNQV GLRTLNFGPC TEDIENQARL HRTDLRWRDD  300
LKENRLFPKM DEDTEKEFAK ETNWSNLSMN VGSQGGNRNV NSSYVDGRLN GIDADIKLFH  360
QAPTDRSDST KPEKQVSPQE YKLPYFAPKL DLNTDDQTDA ASSCKQLDLN GFSWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2244100157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2243100158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543534.10.0PREDICTED: uncharacterized protein LOC107843680 isoform X1
SwissprotQ9SQQ91e-126PHL9_ARATH; Myb-related protein 2
TrEMBLA0A2G2YMX50.0A0A2G2YMX5_CAPAN; Myb family transcription factor APL
STRINGSolyc10g083340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-128G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]