PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g14880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 215aa    MW: 24721 Da    PI: 9.9732
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g14880genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.11.3e-2231118290
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 +YneYA+++GFsvrk++ +k++ +g +t+ +f+C+keg+r+ +k++ +  +++r+etrtgC a++  +++++g++++t++e +H+ +l+
  CA10g14880  31 CYNEYATSIGFSVRKEYANKNRVQGYVTSTKFTCYKEGYRNIDKRD-SMVKKHRKETRTGCLAHIITSRRSNGVFRITSFEDKHSYPLV 118
                 7******************************************999.99999*********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2031118IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MDPTSTKPQG ECNVSIKLGM KFDSDEHAYE CYNEYATSIG FSVRKEYANK NRVQGYVTST  60
KFTCYKEGYR NIDKRDSMVK KHRKETRTGC LAHIITSRRS NGVFRITSFE DKHSYPLVDP  120
TLSHLLPSQR NIKVVQAYEL DLLDDSGIRP KASFEYAARQ AGGQFFLGYT KGDHKNYLRD  180
KRQESLKRGV GRSLVNYFEK KNTRRSCFSI FFAV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018631664.11e-108PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G2YMG21e-140A0A2G2YMG2_CAPAN; Uncharacterized protein
STRINGXP_009619707.12e-98(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-26FAR1-related sequence 5