PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g08130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SRS
Protein Properties Length: 204aa    MW: 23222.1 Da    PI: 8.141
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g08130genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702181.92.7e-56161545154
      DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelets 103
                   +CqdCGnqakkdC + RCRtCCksr ++C+thvkstW+p++ rr r+  l++         ++ ++kr re+++ ++  +s   + ++ ++     +
  CA10g08130  16 YRRCQDCGNQAKKDCPFLRCRTCCKSRRYQCQTHVKSTWIPVSTRRPRH--LSTI--------QQPNPKRYRENQNPAALYISFLLIFETLQP-IEGEE 103
                 568********************************************83..3332........345677888874444455555555555555.44566 PP

      DUF702 104 slPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 +lP+evs +avfrcvrvss+d+  +++aYqt+v+i+GhvfkGiLydqG+++
  CA10g08130 104 ELPAEVSLPAVFRCVRVSSLDNLVDQYAYQTSVNIAGHVFKGILYDQGPDD 154
                 7************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.6E-5417153IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.7E-251960IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.0E-25105152IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MRSEDDQGIT ISSSNYRRCQ DCGNQAKKDC PFLRCRTCCK SRRYQCQTHV KSTWIPVSTR  60
RPRHLSTIQQ PNPKRYRENQ NPAALYISFL LIFETLQPIE GEEELPAEVS LPAVFRCVRV  120
SSLDNLVDQY AYQTSVNIAG HVFKGILYDQ GPDDDDNIPK ETSSRGFHQH LLTTNLTTPS  180
TSYPTPFTNF MPGTQYFQCP KSS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754497e-46HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055481.12e-88PREDICTED: protein SHI RELATED SEQUENCE 3-like
TrEMBLK4D1053e-83K4D105_SOLLC; Uncharacterized protein
STRINGSolyc10g054070.1.19e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-49SHI-related sequence 5