PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g04740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 133aa    MW: 15114.2 Da    PI: 10.3479
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g04740genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.22.1e-2961110251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 +rlrWtp+LH+rFv+ave+LGG+++AtPk +l+lm++kgL ++hvkSHLQ
  CA10g04740  61 ARLRWTPDLHRRFVHAVERLGGHDRATPKLVLRLMDIKGLNIAHVKSHLQ 110
                 79************************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2757110IPR009057Homeodomain-like
PROSITE profilePS5129410.33357117IPR017930Myb domain
SuperFamilySSF466892.15E-1360111IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2061111IPR006447Myb domain, plants
PfamPF002492.3E-762112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MEDSGGTEFS KTSPNSDKYV DEDENTWIKL QKDGGSSSNS TVEESREKKI SVRSYVRSKM  60
ARLRWTPDLH RRFVHAVERL GGHDRATPKL VLRLMDIKGL NIAHVKSHLQ VNLSLATTKT  120
KYLKYFVIHI NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-1861110251Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1861110251Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1861110251Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1861110251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1861110352Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401972e-70AC240197.3 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-208l2 map 10, complete sequence.
GenBankHG9755222e-70HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552953.11e-75PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A2G2VSP11e-82A0A2G2VSP1_CAPBA; Putative Myb family transcription factor
STRINGPGSC0003DMT4000410713e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-34G2-like family protein