PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g02900
Common NameGLK2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 314aa    MW: 34824.9 Da    PI: 9.481
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g02900genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like841.6e-2695149156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFv+ave+L G +kA+P+++lelm  +gLt+++++SHLQkYR +
  CA10g02900  95 KVKVDWTPELHRRFVKAVEKL-GVDKAVPSRLLELMATDGLTRHNIASHLQKYRAH 149
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.73692151IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2593151IPR009057Homeodomain-like
SuperFamilySSF466895.38E-1794152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2495149IPR006447Myb domain, plants
PfamPF002491.2E-798147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMLVVSTPLS YKNERGNYDL FQDFPDGNLI DTIDFDDFFE GINDGDLLQN LKILDEFDIS  60
KNNTTTNLNV KTKSKENDKS KKSSSQIKNP EGKKKVKVDW TPELHRRFVK AVEKLGVDKA  120
VPSRLLELMA TDGLTRHNIA SHLQKYRAHR KHLLAREAEA ASWTQRKQMY DGAIAIGGGG  180
KRVIMNPWSA PPTMGFPPMA HHIRPLHVWG HPYVNNSFWH PHYQGVPNSL APGTPCFPSP  240
TRFAAALMVP GVPPPFASGQ TPHLHPTKES IDAAIEDVLS KPQTPLPIGL KPPSIDSVLN  300
ELQCQGITKI PPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-1592148258ARR10-B
5lxu_A6e-15100151657Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4203790.0KJ420379.1 Capsicum annuum isolate Maor golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203800.0KJ420380.1 Capsicum annuum isolate 1154 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203810.0KJ420381.1 Capsicum annuum var. glabriusculum isolate Cora14 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203820.0KJ420382.1 Capsicum annuum isolate 1901 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203830.0KJ420383.1 Capsicum annuum isolate PI586677 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203840.0KJ420384.1 Capsicum annuum isolate Grif9094 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203850.0KJ420385.1 Capsicum annuum var. glabriusculum isolate Nayoi3 golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankKJ4203860.0KJ420386.1 Capsicum annuum var. glabriusculum isolate 1202 golden2-like transcription factor (GLK2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545288.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV31e-62GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A1U8EDI60.0A0A1U8EDI6_CAPAN; transcription activator GLK1-like isoform X1
STRINGPGSC0003DMT4000562551e-158(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-62GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Brand A, et al.
    CaGLK2 regulates natural variation of chlorophyll content and fruit color in pepper fruit.
    Theor. Appl. Genet., 2014. 127(10): p. 2139-48
    [PMID:25096887]
  2. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  3. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  4. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  5. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  6. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]