PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g00710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GeBP
Protein Properties Length: 130aa    MW: 15095.4 Da    PI: 10.3488
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g00710genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57332.22.9e-1041884998
      DUF573 49 vsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98
                  + ql +KirrLK K+ ++  k ++gke +++k+h+qk +elskkiW++
  CA10g00710 41 DYRVQLQNKIRRLK-KYMNNAGK-ERGKERVLTKAHEQKEYELSKKIWDK 88
                3468*********8.67777777.7***********************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.3E-91887IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MAADEGETKE SKKSKKKQEK EVETPVKTKA TEHVKLQFFR DYRVQLQNKI RRLKKYMNNA  60
GKERGKERVL TKAHEQKEYE LSKKIWDKEK SDKWVQVEVV KVDNVAVSMG LKKGGVKDNG  120
VLFEVNEEK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016570841.15e-37PREDICTED: uncharacterized protein LOC107868687
TrEMBLM1D1F72e-25M1D1F7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000792156e-25(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947