PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g15380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 441aa    MW: 48718.9 Da    PI: 7.5001
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g15380genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32235290156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  CA09g15380 235 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.22232292IPR017930Myb domain
SuperFamilySSF466897.17E-17233293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28233293IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26235290IPR006447Myb domain, plants
PfamPF002497.6E-7237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MNMTSSNSEL SLECKPHQSY SMLLKSFGEK IDQTQNLEEF LARLEEERVK IDAFKRELPL  60
CMQLLTNAME ASRQQLQSHR ENNHIGHRPI LEEFIPLKNN NNASVELGAE KIVANNTSTI  120
VDNKANWMTS AQLWSPPSDH QETKQVQTSN NTSNKENDHH IGFSISPKLA LDNNSSCPSP  180
TTLALASSNK QNESTIVENH NKNLEGVNIQ QDSQSIGGGT NSTSTSTQQQ QPHRKARRCW  240
SPDLHRRFVN ALQMLGGSQV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSPSPQA  300
TTAPPHLVVL GGIWVPPEYA AAAATHGGAT PAATFYGPHS TSHAPSPHYI AAPQAVTQEF  360
YGTPQPLQSL HHLQHHQQMY HHGSHMYKPP SKSHSHSSPE SDARGTGQHG DRSSESIEDG  420
KSESCSSENG GERKVVVHKF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13235288255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-172HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016540542.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9ZQ851e-100EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A1U8DZU20.0A0A1U8DZU2_CAPAN; Uncharacterized protein
TrEMBLA0A2G2YUK70.0A0A2G2YUK7_CAPAN; transcription factor LUX-like
STRINGSolyc12g006800.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-81G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]