PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g12290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 327aa    MW: 36617.9 Da    PI: 8.0195
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g12290genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.9e-3162115255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +rlrWtp+LH rFv+a+e+LGG+++AtPk il++m+ +gL+++hvkSHLQ+YR+
  CA09g12290  62 ARLRWTPDLHLRFVHAMERLGGQDRATPKLILQMMNTNGLSIAHVKSHLQMYRS 115
                 69***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-2958116IPR009057Homeodomain-like
PROSITE profilePS5129412.21358118IPR017930Myb domain
SuperFamilySSF466892.15E-1461116IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2262117IPR006447Myb domain, plants
PfamPF002495.0E-963114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MLEDSDETGC NSKTSSNFKK NEDETEENGS SKFKDRGSSS DSTLEESEKK PYVRPYVRSK  60
MARLRWTPDL HLRFVHAMER LGGQDRATPK LILQMMNTNG LSIAHVKSHL QMYRSKKMDG  120
QSQGIGHHHK LFMEGGDPNI FNLIRFPMFP AYYQRLNSTF RYGDASWNCH GNWMPTMGQT  180
TLTGTGRGLY TTLNHLCTRI PSFPEIKDVL GSSRGNPSDD LNRLFNIAAK SQARAFDGNG  240
IASSPDLERA ITPLKRKVSE CDLDLNLHLG VRPRIEESTN YDDNDNGSSL SLSLSLSRAT  300
RFIEDANIDA TTENARRGTS TLDLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1762117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1762117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1762117257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1762117257Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754484e-67HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755214e-67HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016549900.10.0PREDICTED: uncharacterized protein LOC107849882
TrEMBLA0A1U8F2M90.0A0A1U8F2M9_CAPAN; Uncharacterized protein
TrEMBLA0A2G2YSY20.0A0A2G2YSY2_CAPAN; uncharacterized protein LOC107849882
STRINGPGSC0003DMT4000685081e-154(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-54G2-like family protein