PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g08750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 133aa    MW: 14538.1 Da    PI: 7.4426
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g08750genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26036.71.2e-1112545597
      DUF260 55 edamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                 ++++sl++eA+ r+ +Pv+Gavg++++++++++ql++e++l 
  CA09g08750 12 AALFQSLLFEACGRTVNPVHGAVGLLWTGNWHVCQLAVETVLK 54
                6789*********************************998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031958.1E-81252IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MEQRTYLSPA SAALFQSLLF EACGRTVNPV HGAVGLLWTG NWHVCQLAVE TVLKGGVLRL  60
LPEFSGVATS PAEFYSASEA NDVDLFRSRC SNFKSKRKVM DEIAEDLDLG LSPRTMVAAG  120
XXRNEGLFLH RR*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016539448.13e-69PREDICTED: LOB domain-containing protein 37-like
SwissprotQ9SN234e-24LBD38_ARATH; LOB domain-containing protein 38
SwissprotQ9SZE84e-24LBD39_ARATH; LOB domain-containing protein 39
TrEMBLA0A2G2YTH44e-90A0A2G2YTH4_CAPAN; LOB domain-containing protein 38
STRINGXP_009625187.13e-54(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9662490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.12e-26LOB domain-containing protein 39