PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g07780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 208aa    MW: 24057.9 Da    PI: 9.2808
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g07780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.51.4e-359105197
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 aCa+Ck++r+kC++ Cvlapyfpae++++f++vhk+FG+sn++k++k+l+e++r++a++sl++eA +r++dPv G +g +++++++l+  k++ +++
  CA09g07780   9 ACASCKHQRKKCTDRCVLAPYFPAEKTREFKAVHKVFGVSNITKIVKNLREDDRRRAVESLIWEAFCRQKDPVLGPYGEYKRVHEELKLYKTQYQQI 105
                 7***************************************************************************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4148109IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-349104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MQKSSGTAAC ASCKHQRKKC TDRCVLAPYF PAEKTREFKA VHKVFGVSNI TKIVKNLRED  60
DRRRAVESLI WEAFCRQKDP VLGPYGEYKR VHEELKLYKT QYQQILHQGS NNNNTDNNGM  120
MYEATTQGLI NGWNINTNRN DNYINHENSI VESWSSYNNK IINPLHHHVQ NIEKLRTENS  180
NGSIVVVPQQ QAYNEFNQQY FLAGRYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-21810610112LOB family transfactor Ramosa2.1
5ly0_B1e-21810610112LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016541258.11e-154PREDICTED: LOB domain-containing protein 2
TrEMBLA0A2G2YU121e-155A0A2G2YU12_CAPAN; LOB domain-containing protein 2
TrEMBLA0A2G3BMI61e-153A0A2G3BMI6_CAPCH; LOB domain-containing protein 2
STRINGSolyc12g010810.1.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-46LOB domain-containing protein 2