PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g04380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 332aa    MW: 37747.8 Da    PI: 7.6549
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g04380genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like63.83.1e-201160454
     G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                 +Wt+ LH++F+ea++ L G+ +  Pk+ile+m+v+gLt+ +v+SHLQk R
  CA09g04380 11 TEWTEALHAKFMEALQLL-GEGRCYPKEILEVMNVPGLTRMQVASHLQKCR 60
                58****************.9*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.103164IPR017930Myb domain
SuperFamilySSF466891.61E-15660IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-19761IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-191161IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MNKIVKRKNC TEWTEALHAK FMEALQLLGE GRCYPKEILE VMNVPGLTRM QVASHLQKCR  60
RNDWRSPEER KSLLRPLVQG SSSDFHESRS SFKKFGTMPH LQIKEPNLNC NPNNTQRNSN  120
HSFPNLSTNN TFAREESPFQ QQFYRPQLHV QSPYLSNFNP FSNQFLSIQN TISGGLQQQQ  180
QQRPLFGMLY SQGLQGPIIK NTNYRSDVMI NNGHHHTQSD YTLNSIVAQG ATYSGNGIVS  240
SRNIRNEISN GYNLNASMDN VTSYSSNATM YGTYVGNVAI NGLEEANPNF QQYIGEPNIS  300
NMNNPFQKLE TPSASLHNEQ DNDFDQVYYD D*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016540998.10.0PREDICTED: putative two-component response regulator ARR20
TrEMBLA0A2G2YR440.0A0A2G2YR44_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000709841e-106(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.16e-13GOLDEN2-like 2