PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g17660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 408aa    MW: 45369 Da    PI: 8.6977
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g17660genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.84.9e-33263318156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  CA08g17660 263 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 318
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.158260320IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-30261321IPR009057Homeodomain-like
SuperFamilySSF466893.33E-18261321IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-27263318IPR006447Myb domain, plants
PfamPF002495.0E-8265316IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSIPPELSL DCRPSFVPES VTDFLRKVSL IRHIPDKLAQ IDDYISRLDD EMRKIEAFKR  60
ELPLSVLLVK DAIGTLREES MQYRKSRKEP VLEEFIPLKK SLDEDTKAEI TAKDKDSREK  120
MSWMSSVQLW NSESHCEKTD EVNNKQPSKS ELKVDTRKSL EEEGHSSITE DPFRSYKTMN  180
VGKAFSPFKG FSVAAVRKDN KDELPGVTGL SLHTPGIAKL REDTVTSGLN SKHNGSRGGL  240
SSAAGCQSNI RTGSLAQQQS ARKQRRCWSP ELHRRFVDAL QQLGGSQVAT PKQIRELMQV  300
DGLTNDEVKS HLQKYRLHTR RVPNSQTQPA NKSGVALGNL WMSQGQYVES SKRSSSQSGS  360
PPGPLHLAVS CGGTSTTVGD SMEEEDDVKS ENHSWKNHVH TSGKIDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13263316154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13263316154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13263316154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13263316154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13263316255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-102HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755131e-102HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016539638.10.0PREDICTED: uncharacterized protein LOC107840319
TrEMBLA0A1U8DX860.0A0A1U8DX86_CAPAN; Uncharacterized protein
TrEMBLA0A2G2Y3S40.0A0A2G2Y3S4_CAPAN; uncharacterized protein LOC107840319
STRINGSolyc01g108300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-53G2-like family protein