PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g17100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 119aa    MW: 13676.7 Da    PI: 8.6933
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g17100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.75.4e-4051051101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk lrrkC+++C++ pyfp ++p++f +vh+++Gasnv k+l+++ e++r d+++sl+yeA +r++dPvyG+vg+i++l++++ +++++l ++++
  CA08g17100   5 RCAACKQLRRKCPSNCIFLPYFPPNNPQRFSYVHRIYGASNVGKMLQQVGEHQRGDVADSLYYEAYWRIKDPVYGCVGIITSLHEEIYHVQSQLPKVQA 103
                 6*********************************************************************************************99998 PP

      DUF260 100 el 101
                 ++
  CA08g17100 104 QI 105
                 85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5194105IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MTSKRCAACK QLRRKCPSNC IFLPYFPPNN PQRFSYVHRI YGASNVGKML QQVGEHQRGD  60
VADSLYYEAY WRIKDPVYGC VGIITSLHEE IYHVQSQLPK VQAQIDLLYQ NGIYTFDP*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754409e-72HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582044.11e-82PREDICTED: LOB domain-containing protein 24-like
SwissprotP594685e-44LBD24_ARATH; LOB domain-containing protein 24
TrEMBLK4B3D75e-76K4B3D7_SOLLC; Uncharacterized protein
STRINGSolyc01g109240.1.11e-75(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-45LOB domain-containing protein 24