PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g11220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 233aa    MW: 25615.4 Da    PI: 6.5823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g11220genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26077.42.5e-245312330100
      DUF260  30 fanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 +a vhk+FGasnv+kll ++p ++r+da+ +++yeA+ar++dPvyG+v++il+lqqq+++l+aelal++++
  CA08g11220  53 HATVHKVFGASNVSKLLLHIPANRRQDAVVTVTYEAQARLSDPVYGCVSTILALQQQVASLQAELALVQTQ 123
                 678****************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.32823124IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-2354121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDEPLTLPLT SNMDEPPSDG ASDQNRRIRG LGKRAAXXXX RALFRLPRPL VVHATVHKVF  60
GASNVSKLLL HIPANRRQDA VVTVTYEAQA RLSDPVYGCV STILALQQQV ASLQAELALV  120
QTQVMNSRYA VANSFQYSQQ QQQEQHVAIL QPSYSNNSSV SNNIKLINNI NGASNFNNST  180
SSTAFDHQLH GSADTCTANN SPSFDPIHQL HDEEEEESHN PLAFTNHMFH SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-215413341118LOB family transfactor Ramosa2.1
5ly0_B4e-215413341118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755137e-62HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016581848.11e-124PREDICTED: LOB domain-containing protein 20-like
TrEMBLA0A2G3BU771e-144A0A2G3BU77_CAPCH; LOB domain-containing protein 20
STRINGPGSC0003DMT4000578291e-76(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03760.19e-28LOB domain-containing protein 20