PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g03640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 145aa    MW: 16316.7 Da    PI: 9.4735
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g03640genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP32.72e-10861164777
                 SSEEETTT--SS--S-STTTT-------S-- CS
         SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  rfh l+efD++k+s r++L +hne +rk++
  CA08g03640  86 LRFHLLDEFDDGKQSYRKHLVGHNEHQRKPH 116
                 59***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS511419.57121115IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.44E-887119IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MRGVGNIFGS LVGVFSGEDK SSSISRDSSL IDLKPGRFPD HISANIFKYP KIMPSFTTTE  60
FIFPAKRIQQ ALLVSSKEEF SLDTLLRFHL LDEFDDGKQS YRKHLVGHNE HQRKPHTSMH  120
SGYKLFLSFA INVVLNFAYC SSTL*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545418.11e-41PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016545419.11e-41PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2G3AMV41e-101A0A2G3AMV4_CAPAN; Uncharacterized protein
STRINGSolyc03g114850.2.13e-26(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-09SBP family protein