PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g02890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 256aa    MW: 28159 Da    PI: 9.1184
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g02890genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.41.2e-38441431100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+Ca+dC+lapyfpa+++k+f n+hklFG+sn+lk+lk++++ ++++am++l++eA++ra dPv G++++il+l++q++  +ael+ + +
  CA08g02890  44 ACAACKYQRRRCAPDCPLAPYFPAKRHKDFLNAHKLFGVSNILKVLKNVSPFQKDNAMKALIFEANIRAGDPVGGCYRTILNLHRQINLCQAELQFVYR 142
                 7********************************************************************************************998766 PP

      DUF260 100 e 100
                 +
  CA08g02890 143 Q 143
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.43443144IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3744139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTNVVNNNTQ NISYLRSSLT TRSSTAAARV ASQGGGSGGN GSQACAACKY QRRRCAPDCP  60
LAPYFPAKRH KDFLNAHKLF GVSNILKVLK NVSPFQKDNA MKALIFEANI RAGDPVGGCY  120
RTILNLHRQI NLCQAELQFV YRQIFRVKAA AIQVQPNINT KACSLNEINN SILGFDFSPI  180
PCLHEFDIST SIGEGSNSQI VEGERLEGFN NEKFEAKTVM SICNDKQSIV EHGDFKPYFG  240
NFHDYKGKGI ATELR*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582127.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-40LBD22_ARATH; LOB domain-containing protein 22
TrEMBLM1DU553e-76M1DU55_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000944389e-76(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA142941012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-37LOB domain-containing protein 22