PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g17550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 112aa    MW: 13115 Da    PI: 7.8723
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g17550genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.86.9e-2453101250
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                 Cqve+C +dl  ak+y++rhkvC+ h+kap vl++gl++rfCqqCsr+ 
  CA07g17550  53 CQVEKCGVDLDGAKKYYKRHKVCQLHAKAPIVLLAGLRHRFCQQCSRYT 101
                 ***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-2248100IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.20450111IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-2251102IPR004333Transcription factor, SBP-box
PfamPF031108.6E-1953100IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MDFVEEDNEF EEEDEEEDET VLIGKNSYLK RKKLNLDKKK GEKSDSMQVK QYCQVEKCGV  60
DLDGAKKYYK RHKVCQLHAK APIVLLAGLR HRFCQQCSRY TLNKTMSSHY F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-1651100958squamosa promoter binding protein-like 4
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579534.13e-67PREDICTED: squamosa promoter-binding-like protein 3
TrEMBLA0A2G2Z5075e-76A0A2G2Z507_CAPAN; Squamosa promoter-binding-like protein 3
STRINGXP_009788885.16e-29(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.17e-20squamosa promoter binding protein-like 3