PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g12470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GeBP
Protein Properties Length: 408aa    MW: 45033.9 Da    PI: 4.9826
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g12470genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573107.97.3e-34159250397
      DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +++lwse+D++++L+G++++k+++g++p +d++afyef++++++++vsksql++KirrLKkKf + vk+   g++p fsk++d  ++e+s++iWg
  CA07g12470 159 PRSLWSEDDQVAILKGMVEYKQEKGTEPNADMSAFYEFIRGKLQADVSKSQLSDKIRRLKKKFMTSVKD---GEQPGFSKTQDWLVYEYSNQIWG 250
                 6789*************************************************************9999...**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.9E-28161250IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MAPKAKSRLV DQPPSASSSE EEQVEESQEE EEQEEQSEEG QEEESGEETE EDEPPKKPIT  60
QKSLQTQPKP VHSSSESGTE NGSGSESQTD SGHSGQSLPS PSASDFTVKP SAPVKAAVPS  120
KEPAKRPPPQ EQAQKESKDS RKKKPKIAEE EEKKASATPR SLWSEDDQVA ILKGMVEYKQ  180
EKGTEPNADM SAFYEFIRGK LQADVSKSQL SDKIRRLKKK FMTSVKDGEQ PGFSKTQDWL  240
VYEYSNQIWG APSNNIVKEN VSSSANDKAK KAAADAVKKI AEPKKSGKVS TLNKAKDNEK  300
RKDEEKEKKV AAIEVVKEDI VNDDKQDFQS KYPRLAASFE SLGGMSMIYP NGTSWLKEKM  360
SSIASDKAEV LEEKWKKLDD AEAALILKRL DLIREHCGLV VDGTRGN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016580681.10.0PREDICTED: neurofilament heavy polypeptide-like
TrEMBLQ94IK21e-140Q94IK2_SOLTU; Storekeeper protein
STRINGSolyc07g052760.1.11e-135(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23692041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.16e-21DNA-binding storekeeper protein-related transcriptional regulator