PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g08390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 110aa    MW: 12813 Da    PI: 11.1422
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g08390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-322779254
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                prlrWtpeLHe F+eav+ LGG +kAtPk+i ++m+vkgLt++hvkSHLQ+YR
  CA07g08390 27 PRLRWTPELHELFIEAVQLLGGGHKATPKRIQQMMEVKGLTISHVKSHLQMYR 79
                8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9142383IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-292481IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-262780IPR006447Myb domain, plants
SuperFamilySSF466891.37E-182783IPR009057Homeodomain-like
PfamPF002491.2E-122879IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MMEYFSMMKK RSSHKIGVRQ YKKSSVPRLR WTPELHELFI EAVQLLGGGH KATPKRIQQM  60
MEVKGLTISH VKSHLQMYRN LKERASPNIV SSVNNFLEER PQFSWSSPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-202884460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579369.16e-74PREDICTED: probable transcription factor KAN3
SwissprotQ700D94e-26MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A2G2Z1N17e-74A0A2G2Z1N1_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000024105e-48(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-29G2-like family protein