PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g27940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 288aa    MW: 33452.5 Da    PI: 6.1404
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g27940genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.52.8e-49101391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                 lppGf+F P+deel+++yL +k++++k l l+  + e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++vl+  ++
  CA06g27940  10 LPPGFKFCPSDEELICHYLYNKIANEKgLVLNGSLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRANRATISGYWKATGKDRTVLDPrTR 108
                 79*********************99996666667***************87788899**************************************9667 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vg++ktLvfyk+rap+g ktdW+mhe+r+
  CA06g27940 109 NIVGMRKTLVFYKNRAPNGIKTDWIMHEFRI 139
                 77***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-588158IPR003441NAC domain
PROSITE profilePS5100555.98410158IPR003441NAC domain
PfamPF023654.9E-2611139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDLREIGATL PPGFKFCPSD EELICHYLYN KIANEKGLVL NGSLVEIDLH TCEPWQLPEV  60
AKLNSSEWYF FSFRDRKYAT GFRANRATIS GYWKATGKDR TVLDPRTRNI VGMRKTLVFY  120
KNRAPNGIKT DWIMHEFRIQ NPQVPLKEDW VLCRVFHKDK GHENNNNNCT NKLNSQNKYE  180
AIVTCSNLSQ SPLHVNQHSL HRDISYQNPP HDEISQNSNA IHHQLFELLV KDHHENTCLS  240
QCGQGDDQCG LLFDMQMDFQ EPYFQEEEIH SSLEDMRFDD ENSAIFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-451015815168Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-85HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576821.10.0PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A2G2ZEK60.0A0A2G2ZEK6_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000519151e-171(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-87NAC domain containing protein 74