PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g25790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 230aa    MW: 26005.3 Da    PI: 9.5638
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g25790genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.73e-41521511100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++p  +r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+++++
  CA06g25790  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKLLMEVPVGQRADAANSLVYEANVRLRDPVYGCMGAISALQQQIQNLQAELNSIRA 150
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  CA06g25790 151 E 151
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.25651152IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-4252149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MNRERMDEMG KKLKTEIIDA SNSQLNMQQL QMGRRHVLGP VAGGTTLNHV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKLLMEV PVGQRADAAN SLVYEANVRL  120
RDPVYGCMGA ISALQQQIQN LQAELNSIRA EILRYKYREA ANSLIIASIS TSVAPELPQA  180
PPXXXXXXXX HHLWWWFRRH HLLLLQFHLI CTHQLRLVWQ TLVPLPIIA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-93HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576847.11e-132PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-71LBD13_ARATH; LOB domain-containing protein 13
TrEMBLK4CAA21e-112K4CAA2_SOLLC; Uncharacterized protein
STRINGSolyc06g082430.1.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.14e-73LOB domain-containing protein 13