PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g25710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 179aa    MW: 19783.5 Da    PI: 7.2706
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g25710genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-4471061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  CA06g25710   7 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPIQQRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAVAQA 105
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  CA06g25710 106 E 106
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8336107IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGTGSSPCAS CKLLRRRCAK DCIFAPYFPP DDPHKFAIVH KVFGASNVSK MLQELPIQQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISFLQ NQVSQLQMQL AVAQAEILCI QMQQEPVPCN  120
LPTTLMEPDQ LDKLPFSTSN NNSNHNNNFN NNLQQYLSFA SSSSSIMQDP VKRESLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4821087112LOB family transfactor Ramosa2.1
5ly0_B2e-4821087112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-120HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576852.11e-131PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW36e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1U8H0671e-129A0A1U8H067_CAPAN; LOB domain-containing protein 12
TrEMBLA0A2G2XZQ51e-129A0A2G2XZQ5_CAPAN; LOB domain-containing protein 12-like
STRINGSolyc06g082310.2.11e-104(Solanum lycopersicum)
STRINGPGSC0003DMT4000782561e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-78LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]