PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g24530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WOX
Protein Properties Length: 113aa    MW: 12957.9 Da    PI: 10.7728
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g24530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-201271357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq++ Le+l+ +  r+psae++++++ +l    +++ ++V++WFqN++a++++
  CA06g24530 12 SRWNPTKEQIDLLESLYGQgIRTPSAEQIQQITGRLrafgHIEGKNVFYWFQNHKARQRQ 71
                6*****************99**************************************97 PP

2Wus_type_Homeobox114.45.6e-371172364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +RW+Pt+eQi +Le+ly +G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqk
         CA06g24530 11 GSRWNPTKEQIDLLESLYGQGIRTPSAEQIQQITGRLRAFGHIEGKNVFYWFQNHKARQRQK 72
                       58***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.398772IPR001356Homeobox domain
SMARTSM003892.9E-4976IPR001356Homeobox domain
SuperFamilySSF466893.34E-121076IPR009057Homeodomain-like
PfamPF000462.5E-181271IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-81271IPR009057Homeodomain-like
CDDcd000862.22E-51373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MLTTSGGTPV GSRWNPTKEQ IDLLESLYGQ GIRTPSAEQI QQITGRLRAF GHIEGKNVFY  60
WFQNHKARQR QKEKQDKFAY FNQFLLRTPV FPPPNCPNGK FLLLFLLSGR FI*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-90HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576871.13e-68PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K12e-44WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A2G2ZDX65e-69A0A2G2ZDX6_CAPAN; WUSCHEL-related homeobox 2
STRINGSolyc06g076000.1.11e-59(Solanum lycopersicum)
STRINGPGSC0003DMT4000779471e-59(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-46WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  3. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]