PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g22960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family bZIP
Protein Properties Length: 503aa    MW: 55776.5 Da    PI: 7.3332
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g22960genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11.1e-09199239545
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                 k  rr+++NReAA++sR RKka++++Le+    L++  ++L
  CA06g22960 199 KTLRRLAQNREAAKKSRIRKKAYVQQLETSRMRLSQLEQEL 239
                 6789************************9877777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-5193272IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-7197240No hitNo description
PROSITE profilePS502179.151197241IPR004827Basic-leucine zipper domain
PfamPF077161.7E-7197241IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.19E-7199241No hitNo description
PROSITE patternPS000360202217IPR004827Basic-leucine zipper domain
PfamPF141446.9E-32280354IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MASQGIGETG LTDSGPSSHS HHNHNMPYAV YRGINPASTS FINQESSGFD FGELEEAFVL  60
QGFKISNDEA KASLYAAAAA TGKPAATLEM FPSWPMRFQQ TPREKSKSRE ESTDSGSLSS  120
RVQPHLEPES PISRKASSDH QQNQLHITHK SQEQQQQLQN MASNNPRTGG LQTELAASKS  180
NSEKKKGAAS TSERVLDPKT LRRLAQNREA AKKSRIRKKA YVQQLETSRM RLSQLEQELQ  240
RASSQGIFLG GGTTAGSNIS SGAAIFDMEY SRWLDDDQRH MSELRTALQA HLSDGDLRLI  300
VDGYIAHYDE IFCLKGVAAK SDVFHLITGM WTTPAERCFL WMGGFRPSEL IKMLIGQLDP  360
LTEQQVVGIY SLQQSSQQAE DALSQGLEQL QQSLIDTIAT ASLHDGMHHM ALALGKLSNL  420
EGFVRQADNL RQQTLHQLHR ILTVRQAARC FLVIGEYYGR LRALSSLWLS RPRETLIVDD  480
NSCQTITGLQ MVQSSQNHFS NF*
Functional Description ? help Back to Top
Source Description
UniProtTogether with TGA10, basic leucine-zipper transcription factor required for anther development, probably via the activation of SPL expression in anthers and via the regulation of genes with functions in early and middle tapetal development (PubMed:20805327). Required for signaling responses to pathogen-associated molecular patterns (PAMPs) such as flg22 that involves chloroplastic reactive oxygen species (ROS) production and subsequent expression of H(2)O(2)-responsive genes (PubMed:27717447). {ECO:0000269|PubMed:20805327, ECO:0000269|PubMed:27717447}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00131DAPTransfer from AT1G08320Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by flg22 in leaves. {ECO:0000269|PubMed:27717447}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT6933870.0KT693387.1 Capsicum annuum AILZ1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311996.10.0transcription factor TGA2
SwissprotQ93XM60.0TGA9_ARATH; Transcription factor TGA9
TrEMBLA0A0N9H8B20.0A0A0N9H8B2_CAPAN; AILZ1
STRINGSolyc06g074320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36832340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08320.30.0bZIP family protein
Publications ? help Back to Top
  1. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  2. Noshi M,Mori D,Tanabe N,Maruta T,Shigeoka S
    Arabidopsis clade IV TGA transcription factors, TGA10 and TGA9, are involved in ROS-mediated responses to bacterial PAMP flg22.
    Plant Sci., 2016. 252: p. 12-21
    [PMID:27717447]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]