PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g16130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 337aa    MW: 38421.3 Da    PI: 6.1353
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g16130genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.78.3e-38621611100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+s ++k++++l++  +++am+++++++++ra+dPv G++++i++lq++++  kael+ + +
  CA06g16130  62 ACAACKYQRRKCAPDCALAPYFPHDRQRQFLNAHKLFGVSSITKIIRHLDQPLKDEAMRTIIFQSDVRANDPVGGCYRIIRDLQHHIDYCKAELDIVLH 160
                 7*********************************************************************************************98877 PP

      DUF260 100 e 100
                 +
  CA06g16130 161 Q 161
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.71661162IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3562157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MTSFSTSNNN NIAIHHHHHQ TPHTFISDHN NLNHHKYTKR VHNNNDNNHK NVLLRVSGAG  60
QACAACKYQR RKCAPDCALA PYFPHDRQRQ FLNAHKLFGV SSITKIIRHL DQPLKDEAMR  120
TIIFQSDVRA NDPVGGCYRI IRDLQHHIDY CKAELDIVLH QLAYCRAQAV AAAAVSEQQQ  180
ILTDHHAADQ ESFNDNNCDG VVNQADPLVN YNNASPYEQQ PIDQYHPHYS YYNHPRDQQT  240
EDDQQYDEIQ DGQLDLADIN FPWSLHEQES TSTSAPNSMM KQLSVNDQCD NIKEPILEGI  300
SGFGSFEQDQ TFDQHRSVTA LCSLFFDYLD VLSLSI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578570.10.0PREDICTED: LOB domain-containing protein 22
TrEMBLM1A1B20.0M1A1B2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000124980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-52LOB domain-containing protein 22