PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g15140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 333aa    MW: 36071.1 Da    PI: 6.9737
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g15140genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.95.5e-3446100155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  CA06g15140  46 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 100
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.33743103IPR017930Myb domain
SuperFamilySSF466894.12E-1845100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-3245101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-2646101IPR006447Myb domain, plants
PfamPF002491.4E-94899IPR001005SANT/Myb domain
PfamPF143793.0E-22132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MYQPKGVPTS SLAHNNVAVN NQSLDCAGGS MDPISGGNNN PSLASKQRLR WTNELHERFV  60
DAVAQLGGPD RATPKGVLRV MGVQGLTIYH VKSHLQKYRL AKYLPDSSSD GKNSDKKEPR  120
DMLSSLDGSS GVEITTALKL QMEVQKRLHE QLEVQKQLQL RIEAQGKYLK KIIEEQQRLS  180
GVLSEVPGSG VTAPPTGDNG PESDNRTDPG TPAPSSESPH VDKPVKAHAL TKSLSMDESF  240
SSHHEPLSPD SDFHETSPIE SPNGERSSKK QRVGTSAAFT KDNMALPHQI LESSLSSPYQ  300
QPHSAFMTRD QFNFTSGLSL GIDDQKVSGS NI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-2446103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-2446103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-2446103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-2446103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-2446103259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556346.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ9SJW01e-118PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A1U8FCD00.0A0A1U8FCD0_CAPAN; protein PHR1-LIKE 1
TrEMBLA0A2G2ZAZ50.0A0A2G2ZAZ5_CAPAN; Protein PHR1-LIKE 1
STRINGPGSC0003DMT4000190990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-112G2-like family protein