PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g13740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 247aa    MW: 27384.1 Da    PI: 9.244
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g13740genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-322781155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt eLH++Fv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  CA06g13740 27 KPRLRWTAELHDQFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 81
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-312481IPR009057Homeodomain-like
PROSITE profilePS5129412.5632484IPR017930Myb domain
SuperFamilySSF466891.97E-162782IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-242782IPR006447Myb domain, plants
PfamPF002492.5E-92980IPR001005SANT/Myb domain
PfamPF143794.1E-19127172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MYNSSGMGRG GGFMYENDGV VMTRDPKPRL RWTAELHDQF VDAVTKLGGP DKATPKSVLR  60
LMGLKGLTLY HLKSHLQKYR LGQLAKKQNA AEANKENCGD SGQFSLHSSG PSTSSLSMNF  120
MQGEVVPVAD AVMYQIEVQK RLQEQLQVQQ KLQMRIEAQG KYLQAILDKA QKKLPNMNSP  180
SAPEATTAQL TAFSSPLSNL LDYTVHGENR DNNIELLPTP NHIVEKEQKN DMNSINFDLN  240
SRSSFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-202780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-202780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-202780154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-202780154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-202780255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754456e-44HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755186e-44HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574986.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotC0SVS49e-71PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A1U8GUR40.0A0A1U8GUR4_CAPAN; Myb family transcription factor APL
TrEMBLA0A2G2ZAL40.0A0A2G2ZAL4_CAPAN; myb family transcription factor APL-like isoform X2
STRINGPGSC0003DMT4000526951e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-48G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]