PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g13390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 356aa    MW: 41352 Da    PI: 8.0115
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g13390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR150.95.3e-1622107290
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  Yn YA    F vrk  ++k+ rn+eit+  f Cs eg++++ +   ++ +r+r e r+gC a++k k + ++ w+v +++  H+H++ 
  CA06g13390  22 AYNLYAVVKDFGVRKGPKTKN-RNNEITRCLFLCSYEGQSDKLSPF-QEMKRQRLEYRCGCLARIKFKIS-NDMWKVCEFNDVHSHPMI 107
                 59***************9999.5566**************999988.9999*****************99.9**************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.9E-1322107IPR004330FAR1 DNA binding domain
PfamPF105518.3E-28229323IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDKNFVFEIG MKFDSEEESY NAYNLYAVVK DFGVRKGPKT KNRNNEITRC LFLCSYEGQS  60
DKLSPFQEMK RQRLEYRCGC LARIKFKISN DMWKVCEFND VHSHPMIEGN LRHFIQSGRK  120
LTSATKNILG SMVEAGIRTK KAIRYLQKEA GGIKNTEFIE QDAHNFIQAH KRNIISGGDA  180
QALINHFMHL QSEDSNFFYS FQVDEDGRFC NFFWRDSISR MHYECFGDVI IFDTTYRTNK  240
YNMICATFVG VNNHWKNIFF GCAFLCDETT SYFTWLFQAF LKGMGEKTPT TIFTDQAPTI  300
AAVVREVFPE TCHQLCEWYI DRNAQKIYPI FTGNKDFKTT SILSYGDASQ NQNLK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019261901.11e-129PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G2ZAF90.0A0A2G2ZAF9_CAPAN; Uncharacterized protein
STRINGSolyc03g044690.1.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1726931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-60FAR1-related sequence 5