PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g08920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 187aa    MW: 20124.1 Da    PI: 7.8765
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g08920genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.48.8e-42151141100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++p+++r d+++slvyeA++r+rdPvyG++g i++lqqq++ l+ael+++++
  CA06g08920  15 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPKSQRADTANSLVYEANVRLRDPVYGCMGAISALQQQVHALQAELNVIRA 113
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  CA06g08920 114 E 114
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.26514115IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-4215112IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MLVPPGSTTS NTVTPCAACK LLRRRCAQEC PFSPYFSPHE PQKFASVHKV FGASNVSKML  60
MEVPKSQRAD TANSLVYEAN VRLRDPVYGC MGAISALQQQ VHALQAELNV IRAEIMKYNT  120
SLTPSSHITS LLSSGEVSVV ALPPPPPSLI LPPTIFSADA IMYTQPSTTT TEFSTISSEN  180
NISYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4781184114LOB family transfactor Ramosa2.1
5ly0_B7e-4781184114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-71HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-71HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577136.11e-134PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T55e-69LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2G2Z9N61e-134A0A2G2Z9N6_CAPAN; LOB domain-containing protein 15
STRINGSolyc06g050430.2.14e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.15e-67LOB domain-containing protein 13
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]