PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g07520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 207aa    MW: 22683.6 Da    PI: 5.2152
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g07520genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.96.3e-42431421100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la++++
  CA06g07520  43 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPEFQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVNELQVQLAKAQA 141
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  CA06g07520 142 E 142
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.98342143IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4243140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEHSTDTTTA TTITPSPYSS RSVSPSSSSP PDSPPLPQVV VSPCAACKIL RRRCAEKCVL  60
APYFPPNDPI KFTTAHRVFG ASNIIKFLQE LPEFQRADAV SSMVYEANAR LRDPVYGCAG  120
AICQLQKQVN ELQVQLAKAQ AEIVNMQHEQ ANFMTLICME MAQSPQTSPQ QSLENFTNIP  180
QHGSSQSDVS FLDESNFGSI WETLWA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755183e-76HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
GenBankHG9754453e-76HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577197.11e-153PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM1CDT51e-110M1CDT5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000653461e-110(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-67LOB domain-containing protein 1