PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g06970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 378aa    MW: 42504.9 Da    PI: 9.4187
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g06970genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.13.1e-3173126255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtpeLH rF +ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ+YR+
  CA06g06970  73 PRLRWTPELHLRFAHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRS 126
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2969127IPR009057Homeodomain-like
PROSITE profilePS5129411.89769129IPR017930Myb domain
SuperFamilySSF466891.72E-1570128IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2273128IPR006447Myb domain, plants
PfamPF002495.0E-1074125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEGGSSSTEE SKLSPKNQIE FGEEEEGEDD LETEEKSKAQ GTTRTSSSNS TVEENGKKTN  60
SGSVRQYVRS KTPRLRWTPE LHLRFAHAVE RLGGQDRATP KLVLQLMNIK GLSIAHVKSH  120
LQMYRSKKTD DPSQISTDGR TLLENGDHHI FNLTQLPRLQ GYNQTSSSSL RYENALWSRQ  180
PNSMYNSYNV NIGGGSRTST RHGFASHING FSSDGQLFPW NKPIDTEKNQ NRPQFLQNQR  240
FWPTQIGISS AKQNLLMTLQ FNRNTVETAT QFNRREQEMM TQVRANISLS SSRGKGWTSE  300
EVAGTITSTS NKRKIHDSEI NLDLNLSLKA TREDHDDHLK RLKAEQVGDL LSLSLYSSST  360
NDQENNGKKA NTLDLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1674128357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1674128357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1674128357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1674128357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754458e-72HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577168.10.0PREDICTED: putative two-component response regulator ARR13 isoform X2
TrEMBLA0A1U8H7W20.0A0A1U8H7W2_CAPAN; putative two-component response regulator ARR13 isoform X2
STRINGXP_009791663.11e-166(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-50G2-like family protein