PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g02870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 252aa    MW: 27724.8 Da    PI: 8.4841
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g02870genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.21.8e-40491481100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkCa++C+++ yf  ++p+kfa+vhk+FGasnv+kll ++ e++r da++slvyeA++r+rdPvyG++g i++l+qq+++l+ael+++++
  CA06g02870  49 PCAACKLLRRKCAEECPFSLYFSPHEPQKFAVVHKVFGASNVSKLLMEVAENQRADAANSLVYEANVRLRDPVYGCMGAISSLNQQVQSLQAELNATRA 147
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  CA06g02870 148 E 148
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.67948149IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-3949146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
ERLVDEIVGK KLKIENIDAS SKLLHIQQIV GKRHHILEPS CTKLNTIIPC AACKLLRRKC  60
AEECPFSLYF SPHEPQKFAV VHKVFGASNV SKLLMEVAEN QRADAANSLV YEANVRLRDP  120
VYGCMGAISS LNQQVQSLQA ELNATRAEIL RYKYREATNS LVNIASTGVG AAVTLAELPX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXGSFYALSS TTATAAPRVS GCCCPLLFFA  240
FFTSAFVANS F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-434915211114LOB family transfactor Ramosa2.1
5ly0_B5e-434915211114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-103HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-103HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577243.11e-127PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT612e-67LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2G2Z7B61e-152A0A2G2Z7B6_CAPAN; LOB domain-containing protein 15 (Fragment)
STRINGSolyc06g007390.2.11e-109(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.16e-70LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]